PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1246s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 315aa    MW: 35002.1 Da    PI: 8.0054
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1246s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.83.9e-20214248135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C tt+Tp+WR+gp+g+ktLCnaCG+++r+ +l
  Araha.1246s0003.1.p 214 CTHCETTNTPQWREGPSGPKTLCNACGVRFRSGRL 248
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.2E-19208258IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-14210270No hitNo description
PROSITE profilePS5011412.057212244IPR000679Zinc finger, GATA-type
CDDcd002021.15E-16213262No hitNo description
Gene3DG3DSA:3.30.50.102.5E-15213245IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440214239IPR000679Zinc finger, GATA-type
PfamPF003207.2E-18214248IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MSNGSWLPEE DFKGLSDNFF DNLIDPNDDF SLEDIETADD EGDWDAGFQN LVPPPLDVLT  60
SLSSEFSCNG QRVPVQKPVP SLKQSCSSEA STVDNSSADV KVSKLFQSSS PVSVLENTNG  120
SVSSLNLHRA LKLAFPVKGI RNKRKRPTLL RVTFLQAFGF EMSQQFAPDE SESEINLSSE  180
ISANKKRKRN KSRPTHQVHN SPKPFNSNGR VQKCTHCETT NTPQWREGPS GPKTLCNACG  240
VRFRSGRLVP EYRPASSPTF IPTVHSNMHR KIIQMRSKDE GQFDTRKIRA MTSRAETKTG  300
LCNFGSEKQD CEDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880933.10.0hypothetical protein ARALYDRAFT_901675
SwissprotQ9SKN61e-138GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLD7LHN70.0D7LHN7_ARALL; Putative uncharacterized protein
STRINGscaffold_401176.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.11e-135GATA transcription factor 13